National Center of Plant Gene Research (Wuhan)
Welcome!
 
Back home
General information of the research and database
Search in Rice Mutants Database
BLAST against Rice Mutants Database
Hotspot links
Suggestions
Contact us

Login NOW!
New User (FREE register)
Forget Your Password?
a. NOTICE for charge     b .Expression Pattern Lines Help

Help Documents

Q1. What's RMD?
RMD (Rice Mutant Database) is an archive for collecting, managing, and searching information of the T-DNA insertion mutants generated by an enhancer trap system. We have generated approximate 129,000 rice mutant (enhancer trap) lines that are now being gathered in the database. Information collected in RMD includes mutant phenotypes, reporter-gene expression patterns, flanking sequences of T-DNA insertional sites, seed availability and others, and can be searched by respective ID, keyword, nucleotide sequence or protein sequence on the website.
Q2. How to search in RMD?
You can search target by Entry ID or Keywords. You also can hit flanking sequences by running 'BLAST Search'.
Q3. Programs available for the BLAST search

blastn
compares a nucleotide query sequence against a nucleotide sequence database

tblastn
compares a protein query sequence against a nucleotide sequence database dynamically translated in all reading frames

tblastx
compares the six-frame translations of a nucleotide query sequence against the six-frame translations of a nucleotide sequence database.
Q4. FASTA format description

A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column. It is recommended that all lines of text be shorter than 80 characters in length. An example sequence in FASTA
format is:

>gi|532319|pir|TVFV2E|TVFV2E envelope protein
ELRLRYCAPAGFALLKCNDADYDGFKTNCSNVSVVHCTNLMNTTVTTGLLLNGSYSENRT
QIWQKHRTSNDSALILLNKHYNLTVTCKRPGNKTVLPVTIMAGLVFHSQKYNLRLRQAWC
HFPSNWKGAWKEVKEEIVNLPKERYRGTNDPKRIFFQRQWGDPETANLWFNCHGEFFYCK
MDWFLNYLNNLTVDADHNECKNTSGTKSGNKRAPGPCVQRTYVACHIRSVIIWLETISKK
TYAPPREGHLECTSTVTGMTVELNYIPKNRTNVTLSPQIESIWAAELDRYKLVEITPIGF
APTEVRRYTGGHERQKRVPFVXXXXXXXXXXXXXXXXXXXXXXVQSQHLLAGILQQQKNL
LAAVEAQQQMLKLTIWGVK

Sequences are expected to be represented in the standard IUB/IUPAC amino acid and nucleic acid codes, with these exceptions: lower-case letters are accepted and are mapped into upper-case; a single hyphen or dash can be used to represent a gap of indeterminate length; and in amino acid sequences, U and * are acceptable letters (see below). Before submitting a request, any numerical digits in the query sequence should either be removed or replaced by appropriate letter codes (e.g., N for unknown nucleic acid residue or X for unknown amino acid residue).
The nucleic acid codes supported are:
        A --> adenosine           M --> A C (amino)
        C --> cytidine            S --> G C (strong)
        G --> guanine             W --> A T (weak)
        T --> thymidine           B --> G T C
        U --> uridine             D --> G A T
        R --> G A (purine)        H --> A C T
        Y --> T C (pyrimidine)    V --> G C A
        K --> G T (keto)          N --> A G C T (any)
                                  -  gap of indeterminate length
For those programs that use amino acid query sequences (BLASTP and TBLASTN), the accepted amino acid codes are:

    A  alanine                         P  proline
    B  aspartate or asparagine         Q  glutamine
    C  cystine                         R  arginine
    D  aspartate                       S  serine
    E  glutamate                       T  threonine
    F  phenylalanine                   U  selenocysteine
    G  glycine                         V  valine
    H  histidine                       W  tryptophan
    I  isoleucine                      Y  tyrosine
    K  lysine                          Z  glutamate or glutamine
    L  leucine                         X  any
    M  methionine                      *  translation stop
    N  asparagine                      -  gap of indeterminate length
Q5. BLAST Search main parameters
DESCRIPTIONS
Restricts the number of short descriptions of matching sequences reported to the number specified; default limit is 100 descriptions. See also EXPECT.
ALIGNMENTS
Restricts database sequences to the number specified for which high-scoring segment pairs (HSPs) are reported; the default limit is 100. If more database sequences than this happen to satisfy the statistical significance threshold for reporting (see EXPECT below), only the matches ascribed the greatest statistical significance are reported.
EXPECT
The statistical significance threshold for reporting matches against database sequences; the default value is 10, such that 10 matches are expected to be found merely by chance, according to the stochastic model of Karlin and Altschul (1990). If the statistical significance ascribed to a match is greater than the EXPECT threshold, the match will not be reported. Lower EXPECT thresholds are more stringent, leading to fewer chance matches being reported. Fractional values are acceptable.
Q6. How to obtain seeds or materials in RMD?
Seeds of the enhancer trap lines or mutants in this database can be requested for research purpose by downloading the request form (PDF format) and sending an e-mail to Dr. Changyin Wu.
Q7. How to contact us?
Mail address:
Changyin Wu
National Center of Plant Gene Research
Huazhong Agricultural University
Wuhan, 430070
P.R.China
E-mail address:

zaiai@ncpgr.cn

Telephone & fax No.:

+86 27 87282044 or 87287092

© 2012 All Rights Reserved, National Center of Plant Gene Research (Wuhan).
Recommend: 1024*768, IE6.0/Netscape7.0 or higher Constructed by Zhang Jianwei
Update by Zhang Chengjun, E-mail:rmd_order@mail.hzau.edu.cn
鄂ICP备05018538号